PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G016700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 189aa    MW: 21580.2 Da    PI: 8.9973
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G016700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.4e-213495157
                         TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         ++ R+++t+eq+++L elF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Manes.10G016700.1.p 34 KCGRWNPTSEQVKVLTELFKSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 95
                         568*****************99**************************************97 PP

2Wus_type_Homeobox114.45.7e-373497265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         ++ RW+Pt+eQ+k+L+el+ksGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
  Manes.10G016700.1.p 34 KCGRWNPTSEQVKVLTELFKSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 97
                         678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2243196IPR001356Homeobox domain
SMARTSM003892.3E-433100IPR001356Homeobox domain
PfamPF000462.4E-183595IPR001356Homeobox domain
SuperFamilySSF466899.84E-123698IPR009057Homeodomain-like
CDDcd000864.04E-53797No hitNo description
Gene3DG3DSA:1.10.10.609.9E-93795IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MAERTSSFCC TKAKARNGIR ASSDDGNNCG SGTKCGRWNP TSEQVKVLTE LFKSGLRTPS  60
TDQIQKISSQ LSFYGKIESK NVFYWFQNHK ARERQKRRRV SVDEKEIIIR RDDSLSAASA  120
RYFSEISNVS VPERVIETLQ LFPLNSFNEG ESEKLRFQEN ECKEPTSFSY RFGAEMDHPP  180
LDLRLSFL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KRRRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526863.13e-96PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D22e-61WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLB9SLJ44e-96B9SLJ4_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0010s19950.12e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-62WUSCHEL related homeobox 5